PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G089700.1
Common NameB456_001G089700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 254aa    MW: 29357.8 Da    PI: 8.0652
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G089700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.69.2e-31192246256
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         +r++W++eLH+rFvea++ LGG+e+AtPk+i++lm+v+gLt+e+vkSHLQkYRl+
  Gorai.001G089700.1 192 NRRCWSSELHSRFVEALNMLGGIEVATPKQIKNLMQVEGLTIEQVKSHLQKYRLH 246
                         79***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-17189249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-26190248IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-25191247IPR006447Myb domain, plants
PfamPF002493.9E-8193244IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MIFLIPFSGK KARCKTMNPS SIELSLSLKP SYVPKSISSL LLDLSKIDNQ YYKLSVLNDY  60
ICKLEEELAR VQPLKHLLPL CTLLLMEETE TLKHELLNIN NEKEQREIQE ECYANFQSCK  120
EKGNNMERLM LGCKENSTWN SVGESSSDGK GKEVAAIDEY SWRNDNQGFM YLNNYDHHHH  180
PKPLTQPIWK NNRRCWSSEL HSRFVEALNM LGGIEVATPK QIKNLMQVEG LTIEQVKSHL  240
QKYRLHYGKV RLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5822326e-84JX582232.1 Gossypium hirsutum clone NBRI_GE15026 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447289.11e-176PREDICTED: uncharacterized protein LOC105770575 isoform X1
TrEMBLA0A0D2PP380.0A0A0D2PP38_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15410716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.18e-23G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]